Gematria Calculation Result for ampyx on Chaldean Numerology
The phrase "ampyx" has a gematria value of 19 using the Chaldean Numerology system.
This is calculated by summing each letter's value: a(1) + m(4) + p(8) + y(1) + x(5).
ampyx in other Gematria Types:
English Gematria:474
Simple Gematria:79
Jewish Gematria:791
Rabbis (Mispar Gadol):1411
Reversed Reduced Gematria:20
Hebrew English Gematria:211
Reduced Gematria:25
Reversed Simple Gematria:56
Reversed English Gematria:336
Hebrew Gematria:0
Paleo Hebrew Gematria:0
Roman Numeral Gematria:1010
Greek Isopsephy:0
Arabic Abjad:0
Satanic Gematria:254
Reverse Satanic:231
Primes Gematria:282
Reverse Primes:183
Trigonal Gematria:853
Reverse Trigonal:531
Squares Gematria:1627
Reverse Squares:1006
Chaldean Numerology:19
Septenary Gematria:10
Single Reduction:25
Full Reduction KV:25
Single Reduction KV:25
Reverse Single Reduction:20
Reverse Full Reduction EP:29
Reverse Single Reduction EP:29
Reverse Extended:875
Jewish Reduction:17
Jewish Ordinal:71
ALW Kabbalah:85
KFW Kabbalah:61
LCH Kabbalah:54
Fibonacci Sequence:326
Keypad Gematria:33
Matching Word Cloud (Value: 19)
20canser20canser1361adamiticadonaiaudreyauroraautismbeautybulgariacalvincancerchesscodecookdakotadanieldantedeathdevileightyfaithfinegeminihollyjumpkevinladderlivedmargaritamayshamneronovaoriginpearlpsalmralphresetsavagesearchsofiฬsomesoulspiritsydneytargettrustvirgowilliamwordwow
View more matches for 19โ"ampyx" stat:
Source: Word Database
Legal rate: 109
Rank: