Gematria Calculation Result for augury on Chaldean Numerology
The phrase "augury" has a gematria value of 19 using the Chaldean Numerology system.
This is calculated by summing each letter's value: a(1) + u(6) + g(3) + u(6) + r(2) + y(1).
augury in other Gematria Types:
English Gematria:558
Simple Gematria:93
Jewish Gematria:888
Rabbis (Mispar Gadol):1398
Reversed Reduced Gematria:33
Hebrew English Gematria:230
Reduced Gematria:30
Reversed Simple Gematria:69
Reversed English Gematria:414
Hebrew Gematria:0
Paleo Hebrew Gematria:0
Roman Numeral Gematria:10
Greek Isopsephy:0
Arabic Abjad:0
Satanic Gematria:303
Reverse Satanic:279
Primes Gematria:323
Reverse Primes:224
Trigonal Gematria:987
Reverse Trigonal:651
Squares Gematria:1881
Reverse Squares:1233
Chaldean Numerology:19
Septenary Gematria:27
Single Reduction:30
Full Reduction KV:30
Single Reduction KV:30
Reverse Single Reduction:33
Reverse Full Reduction EP:33
Reverse Single Reduction EP:33
Reverse Extended:1023
Jewish Reduction:24
Jewish Ordinal:87
ALW Kabbalah:73
KFW Kabbalah:89
LCH Kabbalah:98
Fibonacci Sequence:65
Keypad Gematria:38
Matching Word Cloud (Value: 19)
20canser20canser1361adamiticadonaiaudreyauroraautismbeautybulgariacalvincancerchesscodecookdakotadanieldantedeathdevileightyfaithfinegeminihollyjumpkevinladderlivedmargaritamayshamneronovaoriginpearlpsalmralphresetsavagesearchsofiฬsomesoulspiritsydneytargettrustvirgowilliamwordwow
View more matches for 19โ"augury" stat:
Source: Word Database
Legal rate: 77
Rank:
