Gematria Calculation Result for cribbage on Chaldean Numerology
The phrase "cribbage" has a gematria value of 19 using the Chaldean Numerology system.
This is calculated by summing each letter's value: c(3) + r(2) + i(1) + b(2) + b(2) + a(1) + g(3) + e(5).
cribbage in other Gematria Types:
English Gematria:282
Simple Gematria:47
Jewish Gematria:109
Rabbis (Mispar Gadol):119
Reversed Reduced Gematria:52
Hebrew English Gematria:229
Reduced Gematria:38
Reversed Simple Gematria:169
Reversed English Gematria:1014
Hebrew Gematria:0
Paleo Hebrew Gematria:0
Roman Numeral Gematria:101
Greek Isopsephy:0
Arabic Abjad:0
Satanic Gematria:327
Reverse Satanic:449
Primes Gematria:125
Reverse Primes:618
Trigonal Gematria:272
Reverse Trigonal:1980
Squares Gematria:497
Reverse Squares:3791
Chaldean Numerology:19
Septenary Gematria:30
Single Reduction:38
Full Reduction KV:38
Single Reduction KV:38
Reverse Single Reduction:52
Reverse Full Reduction EP:70
Reverse Single Reduction EP:70
Reverse Extended:3499
Jewish Reduction:37
Jewish Ordinal:46
ALW Kabbalah:125
KFW Kabbalah:125
LCH Kabbalah:85
Fibonacci Sequence:91
Keypad Gematria:26
Matching Word Cloud (Value: 19)
20canser20canser1361adamiticadonaiaudreyauroraautismbeautybulgariacalvincancerchesscodecookdakotadanieldantedeathdevileightyfaithfinegeminihollyjumpkevinladderlivedmargaritamayshamneronovaoriginpearlpsalmralphresetsavagesearchsofiฬsomesoulspiritsydneytargettrustvirgowilliamwordwow
View more matches for 19โ"cribbage" stat:
Source: Word Database
Legal rate: 19
Rank:
