Gematria Calculation Result for niche on Chaldean Numerology
The phrase "niche" has a gematria value of 19 using the Chaldean Numerology system.
This is calculated by summing each letter's value: n(5) + i(1) + c(3) + h(5) + e(5).
niche in other Gematria Types:
English Gematria:234
Simple Gematria:39
Jewish Gematria:65
Rabbis (Mispar Gadol):75
Reversed Reduced Gematria:24
Hebrew English Gematria:75
Reduced Gematria:30
Reversed Simple Gematria:96
Reversed English Gematria:576
Hebrew Gematria:0
Paleo Hebrew Gematria:0
Roman Numeral Gematria:101
Greek Isopsephy:0
Arabic Abjad:0
Satanic Gematria:214
Reverse Satanic:271
Primes Gematria:101
Reverse Primes:337
Trigonal Gematria:207
Reverse Trigonal:1005
Squares Gematria:375
Reverse Squares:1914
Chaldean Numerology:19
Septenary Gematria:20
Single Reduction:30
Full Reduction KV:30
Single Reduction KV:30
Reverse Single Reduction:33
Reverse Full Reduction EP:42
Reverse Single Reduction EP:51
Reverse Extended:1230
Jewish Reduction:29
Jewish Ordinal:38
ALW Kabbalah:79
KFW Kabbalah:87
LCH Kabbalah:42
Fibonacci Sequence:295
Keypad Gematria:19
Matching Word Cloud (Value: 19)
20canser20canser1361adamiticadonaiaudreyauroraautismbeautybulgariacalvincancerchesscodecookdakotadanieldantedeathdevileightyfaithgeminihollyjumpkevinladderlivedmargaritamayshammiracleneronovaoriginpearlpsalmralphresetsavagesearchsofiฬsomesoulspiritsydneytargettrustvirgowilliamwordwow
View more matches for 19โ"niche" stat:
Source: Word Database
Legal rate: 38
Rank:
