Gematria Calculation Result for purity on Chaldean Numerology
The phrase "purity" has a gematria value of 22 using the Chaldean Numerology system.
This is calculated by summing each letter's value: p(8) + u(6) + r(2) + i(1) + t(4) + y(1).
purity in other Gematria Types:
English Gematria:654
Simple Gematria:109
Jewish Gematria:849
Rabbis (Mispar Gadol):1369
Reversed Reduced Gematria:35
Hebrew English Gematria:695
Reduced Gematria:37
Reversed Simple Gematria:53
Reversed English Gematria:318
Hebrew Gematria:0
Paleo Hebrew Gematria:0
Roman Numeral Gematria:6
Greek Isopsephy:0
Arabic Abjad:0
Satanic Gematria:319
Reverse Satanic:263
Primes Gematria:378
Reverse Primes:148
Trigonal Gematria:1118
Reverse Trigonal:334
Squares Gematria:2127
Reverse Squares:615
Chaldean Numerology:22
Septenary Gematria:28
Single Reduction:37
Full Reduction KV:37
Single Reduction KV:37
Reverse Single Reduction:35
Reverse Full Reduction EP:44
Reverse Single Reduction EP:44
Reverse Extended:134
Jewish Reduction:30
Jewish Ordinal:102
ALW Kabbalah:117
KFW Kabbalah:93
LCH Kabbalah:70
Fibonacci Sequence:179
Keypad Gematria:43
Matching Word Cloud (Value: 22)
alephalmightyangelicaanswerbonesbrilliantcarolyncelticschangecodesdeepdivinedoomdowndragondumpdwayneedwardlevellindseymarijuanamessiahmichaelmoneymosesmoveobjectorionpeacepianoplotpostprayersqueenrobertrobotrolexsamuelsecretsoonspringstopswitchswordunclevladimirvoicevoteworldyahusha
View more matches for 22β"purity" stat:
Source: Word Database
Legal rate: 493
Rank: 1319
