Gematria Calculation Result for poignet on Hebrew English Gematria
The phrase "poignet" has a gematria value of 601 using the Hebrew English Gematria system.
This is calculated by summing each letter's value: p(70) + o(60) + i(9) + g(7) + n(50) + e(5) + t(400).
poignet in other Gematria Types:
English Gematria:516
Simple Gematria:86
Jewish Gematria:271
Rabbis (Mispar Gadol):401
Reversed Reduced Gematria:31
Hebrew English Gematria:601
Reduced Gematria:41
Reversed Simple Gematria:103
Reversed English Gematria:618
Hebrew Gematria:0
Paleo Hebrew Gematria:0
Roman Numeral Gematria:1
Greek Isopsephy:0
Arabic Abjad:0
Satanic Gematria:331
Reverse Satanic:348
Primes Gematria:265
Reverse Primes:337
Trigonal Gematria:659
Reverse Trigonal:897
Squares Gematria:1232
Reverse Squares:1691
Chaldean Numerology:33
Septenary Gematria:30
Single Reduction:41
Full Reduction KV:41
Single Reduction KV:41
Reverse Single Reduction:31
Reverse Full Reduction EP:58
Reverse Single Reduction EP:58
Reverse Extended:787
Jewish Reduction:37
Jewish Ordinal:82
ALW Kabbalah:130
KFW Kabbalah:130
LCH Kabbalah:71
Fibonacci Sequence:531
Keypad Gematria:38
Matching Word Cloud (Value: 601)
acceptionadoptingalimentingalkermesalleviationamethodicallyamphibologiesantimediaevallyareolesartassatrberlinesbilandersbinucleolatebiocenoticbitmappeddisclaimerdrawknivesechocardiogramembezzlersencephalographicallyeponymousfloresfluxibilityheptagonhillary rodhamhumificationjunkyardslife cycle of the cicadaloversmarosminutemanmultimachinenationaloutwindowratroyalssassaylorsmyrnasolversparkyspeakerspiderwebtartraunityenginevindicationwhy do i feel so numb
View more matches for 601→"poignet" stat:
Source: Word Database
Legal rate: 11
Rank:
