Gematria Calculation Result for refuge on Hebrew English Gematria
The phrase "refuge" has a gematria value of 229 using the Hebrew English Gematria system.
This is calculated by summing each letter's value: r(200) + e(5) + f(6) + u(6) + g(7) + e(5).
refuge in other Gematria Types:
English Gematria:372
Simple Gematria:62
Jewish Gematria:303
Rabbis (Mispar Gadol):413
Reversed Reduced Gematria:28
Hebrew English Gematria:229
Reduced Gematria:35
Reversed Simple Gematria:100
Reversed English Gematria:600
Hebrew Gematria:0
Paleo Hebrew Gematria:0
Roman Numeral Gematria:5
Greek Isopsephy:0
Arabic Abjad:0
Satanic Gematria:272
Reverse Satanic:310
Primes Gematria:186
Reverse Primes:338
Trigonal Gematria:481
Reverse Trigonal:1013
Squares Gematria:900
Reverse Squares:1926
Chaldean Numerology:29
Septenary Gematria:34
Single Reduction:35
Full Reduction KV:35
Single Reduction KV:35
Reverse Single Reduction:28
Reverse Full Reduction EP:64
Reverse Single Reduction EP:64
Reverse Extended:1315
Jewish Reduction:33
Jewish Ordinal:60
ALW Kabbalah:108
KFW Kabbalah:84
LCH Kabbalah:88
Fibonacci Sequence:73
Keypad Gematria:28
Matching Word Cloud (Value: 229)
aboundinglyackeracknowledgeableacridicafridiaggradedagruifannouncedanopheleapagogicallyapiolinappliedlyarawakarchwayaveragedaxenicallybackbarbajurybarekabeaverybeeherdbefoolingbefrizbenzimidazolebigaradebinoxidebirdiebreezyburakcardiffcoinvolvedeconvolvefreddyfriggfrizzgarveygeburahgrazieherbielamelo ballmedalliononionopulencepleionepoodlequinineuninfixedwavewardwhippingzrazzz
View more matches for 229→"refuge" stat:
Source: Word Database
Legal rate: 9
Rank: