Gematria Calculation Result for zulus on Hebrew English Gematria
The phrase "zulus" has a gematria value of 349 using the Hebrew English Gematria system.
This is calculated by summing each letter's value: z(7) + u(6) + l(30) + u(6) + s(300).
zulus in other Gematria Types:
English Gematria:594
Simple Gematria:99
Jewish Gematria:1310
Rabbis (Mispar Gadol):1530
Reversed Reduced Gematria:27
Hebrew English Gematria:349
Reduced Gematria:18
Reversed Simple Gematria:36
Reversed English Gematria:216
Hebrew Gematria:0
Paleo Hebrew Gematria:0
Roman Numeral Gematria:60
Greek Isopsephy:0
Arabic Abjad:0
Satanic Gematria:274
Reverse Satanic:211
Primes Gematria:351
Reverse Primes:94
Trigonal Gematria:1081
Reverse Trigonal:199
Squares Gematria:2063
Reverse Squares:362
Chaldean Numerology:25
Septenary Gematria:21
Single Reduction:27
Full Reduction KV:18
Single Reduction KV:27
Reverse Single Reduction:27
Reverse Full Reduction EP:27
Reverse Single Reduction EP:27
Reverse Extended:81
Jewish Reduction:20
Jewish Ordinal:92
ALW Kabbalah:49
KFW Kabbalah:113
LCH Kabbalah:85
Fibonacci Sequence:182
Keypad Gematria:37
Matching Word Cloud (Value: 349)
abaculusabuliasacmesacushlaagmasagsamaisledaldebaraniumalidadsamebasamplexicaulineaurocyanidebeaverwoodbezelsbiblusbylawscarnelianchamberlainclamouredclaymorecreepingcylindricaldeionizerdrinkingdromiceiidaeescaladefiscalfleshhighwaysindividualizerismkaryogamymabusmashmismolierenebuchadnezzarnederlandovercivilizephallophobiapurgingrockingscumshamshelfsimslavicsubdividedusmcwelsh
View more matches for 349→"zulus" stat:
Source: Word Database
Legal rate: 49
Rank:
