Gematria Calculation Result for chutzpas on KFW Kabbalah
The phrase "chutzpas" has a gematria value of 138 using the KFW Kabbalah system.
This is calculated by summing each letter's value: c(13) + h(12) + u(25) + t(8) + z(24) + p(26) + a(9) + s(21).
chutzpas in other Gematria Types:
English Gematria:684
Simple Gematria:114
Jewish Gematria:1262
Rabbis (Mispar Gadol):1482
Reversed Reduced Gematria:39
Hebrew English Gematria:795
Reduced Gematria:33
Reversed Simple Gematria:102
Reversed English Gematria:612
Hebrew Gematria:0
Paleo Hebrew Gematria:0
Roman Numeral Gematria:105
Greek Isopsephy:0
Arabic Abjad:0
Satanic Gematria:394
Reverse Satanic:382
Primes Gematria:391
Reverse Primes:339
Trigonal Gematria:1161
Reverse Trigonal:993
Squares Gematria:2208
Reverse Squares:1884
Chaldean Numerology:37
Septenary Gematria:33
Single Reduction:42
Full Reduction KV:33
Single Reduction KV:42
Reverse Single Reduction:48
Reverse Full Reduction EP:48
Reverse Single Reduction EP:57
Reverse Extended:1542
Jewish Reduction:35
Jewish Ordinal:107
ALW Kabbalah:98
KFW Kabbalah:138
LCH Kabbalah:82
Fibonacci Sequence:156
Keypad Gematria:47
Matching Word Cloud (Value: 138)
accommodatorsacidifiantalgicidalamalgamableamygdalaceaeanamorphicanastasiyaashkenaziballoonsbasicallycaliforniacarnivorescelsiuschessboardclairvoyantcoordinatedcorrectingcrossingdandeliondangerousearthboundeducationentrapmentgirlfriendgreatnessguardianshandkerchiefharpocrateshoroscopehuckleberryimmediatelyimpedancelanguagemunchiesnefariousobsessedparalysispegasuspentagonplutocracyprotestantreportingsaymerileescare eventsephirothspecifictiddlywinkstranscripttutankhamenvegetarian
View more matches for 138→"chutzpas" stat:
Source: Word Database
Legal rate: 172
Rank: