Gematria Calculation Result for thus on Primes Gematria
The phrase "thus" has a gematria value of 230 using the Primes Gematria system.
This is calculated by summing each letter's value: t(71) + h(19) + u(73) + s(67).
thus in other Gematria Types:
English Gematria:408
Simple Gematria:68
Jewish Gematria:398
Rabbis (Mispar Gadol):608
Reversed Reduced Gematria:22
Hebrew English Gematria:714
Reduced Gematria:14
Reversed Simple Gematria:40
Reversed English Gematria:240
Hebrew Gematria:0
Paleo Hebrew Gematria:0
Roman Numeral Gematria:5
Greek Isopsephy:0
Arabic Abjad:0
Satanic Gematria:208
Reverse Satanic:180
Primes Gematria:230
Reverse Primes:116
Trigonal Gematria:667
Reverse Trigonal:275
Squares Gematria:1266
Reverse Squares:510
Chaldean Numerology:18
Septenary Gematria:25
Single Reduction:23
Full Reduction KV:14
Single Reduction KV:23
Reverse Single Reduction:31
Reverse Full Reduction EP:22
Reverse Single Reduction EP:31
Reverse Extended:121
Jewish Reduction:20
Jewish Ordinal:65
ALW Kabbalah:50
KFW Kabbalah:66
LCH Kabbalah:52
Fibonacci Sequence:63
Keypad Gematria:27
Matching Word Cloud (Value: 230)
abandoningabentericabetteracceptingaccuratealityanchorableappendanceapsidesarmoredauxinavengesbardilybashersbemoaningbosklanbringingcalendarialcentralcherylchuckycopperdeadlockingenvygalliumgoldfishhallmarkimmediateitalykidnappedlifetimemadisonmahmoudmessiahmpoxnousocimumofficialspackersplasmidplusrabbitssantoschedulescratchscryshutsusitauriunum
View more matches for 230→"thus" stat:
Source: Word Database
Legal rate: 215
Rank: 591
