Gematria Calculation Result for azazyel on Reverse Extended
The phrase "azazyel" has a gematria value of 2064 using the Reverse Extended system.
This is calculated by summing each letter's value: a(800) + z(1) + a(800) + z(1) + y(2) + e(400) + l(60).
azazyel in other Gematria Types:
English Gematria:576
Simple Gematria:96
Jewish Gematria:2027
Rabbis (Mispar Gadol):2337
Reversed Reduced Gematria:30
Hebrew English Gematria:61
Reduced Gematria:33
Reversed Simple Gematria:93
Reversed English Gematria:558
Hebrew Gematria:0
Paleo Hebrew Gematria:0
Roman Numeral Gematria:50
Greek Isopsephy:0
Arabic Abjad:0
Satanic Gematria:341
Reverse Satanic:338
Primes Gematria:351
Reverse Primes:335
Trigonal Gematria:1122
Reverse Trigonal:1080
Squares Gematria:2148
Reverse Squares:2067
Chaldean Numerology:25
Septenary Gematria:13
Single Reduction:33
Full Reduction KV:33
Single Reduction KV:33
Reverse Single Reduction:30
Reverse Full Reduction EP:48
Reverse Single Reduction EP:48
Reverse Extended:2064
Jewish Reduction:23
Jewish Ordinal:86
ALW Kabbalah:60
KFW Kabbalah:108
LCH Kabbalah:80
Fibonacci Sequence:154
Keypad Gematria:39
Matching Word Cloud (Value: 2064)
agrostologicalligatorsalloquialismallostericantaresantimissionaryaspiratingastreanathleticattameazazyelbaittlebarmiestbarrinessbe the lightbelieverbemusedblastoporeceleritiescentralismcirrostrativecloisteralcommonwealcompletementcooperationscorrectercrescentcurvinerveddestroy ungodly k gdiscovertureeight one eightelasticityepsteinqkillswitchexculpationsfibromyxomafraternizeshow are your doritosinviolabilitylord lucifermyxofibromanonassimilatorynonirritabilitypasswaterspolycyclicpreoffensivelypromotus refugito sanussaturn priesthoodsee my g is in controlsquid gamevs five dimensions
View more matches for 2064→"azazyel" stat:
Source: Unknown
Legal rate: 88
Rank: 481