Gematria Calculation Result for corrections on Reverse Extended
The phrase "corrections" has a gematria value of 1823 using the Reverse Extended system.
This is calculated by summing each letter's value: c(600) + o(30) + r(9) + r(9) + e(400) + c(600) + t(7) + i(90) + o(30) + n(40) + s(8).
corrections in other Gematria Types:
English Gematria:834
Simple Gematria:139
Jewish Gematria:510
Rabbis (Mispar Gadol):670
Reversed Reduced Gematria:68
Hebrew English Gematria:1290
Reduced Gematria:58
Reversed Simple Gematria:158
Reversed English Gematria:948
Hebrew Gematria:0
Paleo Hebrew Gematria:0
Roman Numeral Gematria:201
Greek Isopsephy:0
Arabic Abjad:0
Satanic Gematria:524
Reverse Satanic:543
Primes Gematria:441
Reverse Primes:515
Trigonal Gematria:1159
Reverse Trigonal:1425
Squares Gematria:2179
Reverse Squares:2692
Chaldean Numerology:42
Septenary Gematria:44
Single Reduction:67
Full Reduction KV:58
Single Reduction KV:67
Reverse Single Reduction:68
Reverse Full Reduction EP:86
Reverse Single Reduction EP:86
Reverse Extended:1823
Jewish Reduction:60
Jewish Ordinal:132
ALW Kabbalah:155
KFW Kabbalah:155
LCH Kabbalah:113
Fibonacci Sequence:666
Keypad Gematria:58
Matching Word Cloud (Value: 1823)
affixingaltimeteramphoretteasphyxiabirdwomenbismerpundcarvercatterchurchescolonialistsconstitutionalscorrectionscryptogamistcyclospermousdarquisedeflexiondetonatordiverticulumexarteritisextenuationextimulateextortionatefuturespointedgazetteshaptometerhyperdeifyhypervigilanticeboxjoanne rowlingjuanitamultivincularneutropassivenondivergentlynonintegrationoperativelyoutsparspruedoversettlementpathopsychosisphalanxpolygarchysequestrationssportabilitysugaarsupersulfurizedtarantinoteletypewritersthe earthtravestimenttrustingodorgotohellwaterworld
View more matches for 1823→"corrections" stat:
Source: Word Database
Legal rate: 168
Rank: 516
