Gematria Calculation Result for phyllis on Reverse Extended
The phrase "phyllis" has a gematria value of 340 using the Reverse Extended system.
This is calculated by summing each letter's value: p(20) + h(100) + y(2) + l(60) + l(60) + i(90) + s(8).
phyllis in other Gematria Types:
English Gematria:606
Simple Gematria:101
Jewish Gematria:607
Rabbis (Mispar Gadol):947
Reversed Reduced Gematria:34
Hebrew English Gematria:457
Reduced Gematria:38
Reversed Simple Gematria:88
Reversed English Gematria:528
Hebrew Gematria:0
Paleo Hebrew Gematria:0
Roman Numeral Gematria:101
Greek Isopsephy:0
Arabic Abjad:0
Satanic Gematria:346
Reverse Satanic:333
Primes Gematria:333
Reverse Primes:275
Trigonal Gematria:888
Reverse Trigonal:706
Squares Gematria:1675
Reverse Squares:1324
Chaldean Numerology:24
Septenary Gematria:26
Single Reduction:47
Full Reduction KV:38
Single Reduction KV:47
Reverse Single Reduction:43
Reverse Full Reduction EP:43
Reverse Single Reduction EP:52
Reverse Extended:340
Jewish Reduction:40
Jewish Ordinal:94
ALW Kabbalah:77
KFW Kabbalah:125
LCH Kabbalah:42
Fibonacci Sequence:454
Keypad Gematria:41
Matching Word Cloud (Value: 340)
fnforzfoysgimglomgonkhilihillohyppishimgjinnijointwormjookinkonglinpinlophinmigminionnfninomiokimonoopinionphosphylphyllispolo gprotogynyprotohippuspyntugrumrhizopishowishskylinkspikilyswinishsymphonitoxophiltrophoniustyrologyuizhkutlunplugsunshowilyunstrongunwigupgushvigourwoolskinswoufwoughyoghsyounglyzygosity
View more matches for 340→"phyllis" stat:
Source: Word Database
Legal rate: 97
Rank: 886