Gematria Calculation Result for abase on Reverse Primes
The phrase "abase" has a gematria value of 397 using the Reverse Primes system.
This is calculated by summing each letter's value: a(101) + b(97) + a(101) + s(19) + e(79).
abase in other Gematria Types:
English Gematria:168
Simple Gematria:28
Jewish Gematria:99
Rabbis (Mispar Gadol):109
Reversed Reduced Gematria:35
Hebrew English Gematria:309
Reduced Gematria:10
Reversed Simple Gematria:107
Reversed English Gematria:642
Hebrew Gematria:0
Paleo Hebrew Gematria:0
Roman Numeral Gematria:0
Greek Isopsephy:0
Arabic Abjad:0
Satanic Gematria:203
Reverse Satanic:282
Primes Gematria:85
Reverse Primes:397
Trigonal Gematria:210
Reverse Trigonal:1316
Squares Gematria:392
Reverse Squares:2525
Chaldean Numerology:12
Septenary Gematria:15
Single Reduction:19
Full Reduction KV:10
Single Reduction KV:19
Reverse Single Reduction:35
Reverse Full Reduction EP:53
Reverse Single Reduction EP:53
Reverse Extended:2708
Jewish Reduction:18
Jewish Ordinal:27
ALW Kabbalah:52
KFW Kabbalah:76
LCH Kabbalah:58
Fibonacci Sequence:29
Keypad Gematria:16
Matching Word Cloud (Value: 397)
abaseabodeadobeadversityallometryamentulumangulararboristsarylideatrociousattacksatumbleaxisymmetrybarbebipolarborrowingbrayingbreakupcentralclarifycrawlwaysdespairdigimondinosaursemperizeenteritisfablefailurefediagemmulahopefullyhourglasskatrinaleviticusmammalsmutableobjectsophiuchusperipherypredatoryprosecutrixregimensometimesstatelesssurfacetexturelessthousandstradingvictorieswhirlwind
View more matches for 397→"abase" stat:
Source: Word Database
Legal rate: 364
Rank:
