Gematria Calculation Result for abaze on Reverse Primes
The phrase "abaze" has a gematria value of 380 using the Reverse Primes system.
This is calculated by summing each letter's value: a(101) + b(97) + a(101) + z(2) + e(79).
abaze in other Gematria Types:
English Gematria:210
Simple Gematria:35
Jewish Gematria:809
Rabbis (Mispar Gadol):809
Reversed Reduced Gematria:28
Hebrew English Gematria:16
Reduced Gematria:17
Reversed Simple Gematria:100
Reversed English Gematria:600
Hebrew Gematria:0
Paleo Hebrew Gematria:0
Roman Numeral Gematria:0
Greek Isopsephy:0
Arabic Abjad:0
Satanic Gematria:210
Reverse Satanic:275
Primes Gematria:119
Reverse Primes:380
Trigonal Gematria:371
Reverse Trigonal:1281
Squares Gematria:707
Reverse Squares:2462
Chaldean Numerology:16
Septenary Gematria:10
Single Reduction:17
Full Reduction KV:17
Single Reduction KV:17
Reverse Single Reduction:28
Reverse Full Reduction EP:46
Reverse Single Reduction EP:46
Reverse Extended:2701
Jewish Reduction:14
Jewish Ordinal:32
ALW Kabbalah:55
KFW Kabbalah:79
LCH Kabbalah:62
Fibonacci Sequence:9
Keypad Gematria:18
Matching Word Cloud (Value: 380)
accaadvectaliyahallectalphonsoamgarnarauanaraunaarseniumassassinbarroomsbongoistcacaclipperscloudilycreosotedelusionexecutesexplodesfelinefencesgerardhospitalhyperprismimmatureintranetishtars sunjoannakarinakeishakieshalancerlevanamysticalpostulatesprestigeproclivityrabiesrascalroboticsschwabservicessicknesssimchasimulatesumeriansupertramptensorflowtravelerwaffle
View more matches for 380→"abaze" stat:
Source: Word Database
Legal rate: 134
Rank:
