Gematria Calculation Result for added on Reverse Primes
The phrase "added" has a gematria value of 429 using the Reverse Primes system.
This is calculated by summing each letter's value: a(101) + d(83) + d(83) + e(79) + d(83).
added in other Gematria Types:
English Gematria:108
Simple Gematria:18
Jewish Gematria:18
Rabbis (Mispar Gadol):18
Reversed Reduced Gematria:27
Hebrew English Gematria:18
Reduced Gematria:18
Reversed Simple Gematria:117
Reversed English Gematria:702
Hebrew Gematria:0
Paleo Hebrew Gematria:0
Roman Numeral Gematria:1500
Greek Isopsephy:0
Arabic Abjad:0
Satanic Gematria:193
Reverse Satanic:292
Primes Gematria:34
Reverse Primes:429
Trigonal Gematria:46
Reverse Trigonal:1432
Squares Gematria:74
Reverse Squares:2747
Chaldean Numerology:18
Septenary Gematria:18
Single Reduction:18
Full Reduction KV:18
Single Reduction KV:18
Reverse Single Reduction:27
Reverse Full Reduction EP:45
Reverse Single Reduction EP:45
Reverse Extended:2700
Jewish Reduction:18
Jewish Ordinal:18
ALW Kabbalah:44
KFW Kabbalah:44
LCH Kabbalah:87
Fibonacci Sequence:15
Keypad Gematria:14
Matching Word Cloud (Value: 429)
aadamabdaladamaadventistaeropulsealchemyancientandroidassessingatheizeratomicityazoproteinbancabeparsebluestonebugweedcabancleavercoastwisecomplexesconductorconsumptioncoruscantcounterswaycountertypecyberpunkdemythifydysmorphismeuphratesfirestoneflannelfreezingfrequencygillianhilarioushumbledindemnityinfirmarymesophyllumoffspringoverprizedpoilievreradianssandmansatanicshipwrecksorceriesspacesuittranspositoryvilifying
View more matches for 429→"added" stat:
Source: Word Database
Legal rate: 201
Rank: 698