Gematria Calculation Result for dimitri on Reverse Primes
The phrase "dimitri" has a gematria value of 349 using the Reverse Primes system.
This is calculated by summing each letter's value: d(83) + i(61) + m(43) + i(61) + t(17) + r(23) + i(61).
dimitri in other Gematria Types:
English Gematria:492
Simple Gematria:82
Jewish Gematria:241
Rabbis (Mispar Gadol):361
Reversed Reduced Gematria:53
Hebrew English Gematria:671
Reduced Gematria:46
Reversed Simple Gematria:107
Reversed English Gematria:642
Hebrew Gematria:0
Paleo Hebrew Gematria:0
Roman Numeral Gematria:1503
Greek Isopsephy:0
Arabic Abjad:0
Satanic Gematria:327
Reverse Satanic:352
Primes Gematria:249
Reverse Primes:349
Trigonal Gematria:617
Reverse Trigonal:967
Squares Gematria:1152
Reverse Squares:1827
Chaldean Numerology:17
Septenary Gematria:32
Single Reduction:46
Full Reduction KV:46
Single Reduction KV:46
Reverse Single Reduction:53
Reverse Full Reduction EP:53
Reverse Single Reduction EP:53
Reverse Extended:836
Jewish Reduction:43
Jewish Ordinal:79
ALW Kabbalah:132
KFW Kabbalah:92
LCH Kabbalah:67
Fibonacci Sequence:385
Keypad Gematria:36
Matching Word Cloud (Value: 349)
aciesadrowseailieairflowairlessaishaaleemaltezzaamusinganchovyashedautocuebeaksbeginbeingbelleborschtcameocavalcloyingcondomsconsoledeadydimitridioxidsexorcistsfounderhadeshamsterharnessheadshillaryhotlinehypertelyidahointuitionnumericomahapreteritspseudonymrooseveltscreenssegmentshadetypicalunquicklyvampirevirginityyellingyeshuah
View more matches for 349→"dimitri" stat:
Source: Unknown
Legal rate: 307
Rank: 3228
