Gematria Calculation Result for exiguous on Reverse Primes
The phrase "exiguous" has a gematria value of 298 using the Reverse Primes system.
This is calculated by summing each letter's value: e(79) + x(5) + i(61) + g(71) + u(13) + o(37) + u(13) + s(19).
exiguous in other Gematria Types:
English Gematria:726
Simple Gematria:121
Jewish Gematria:861
Rabbis (Mispar Gadol):1381
Reversed Reduced Gematria:41
Hebrew English Gematria:483
Reduced Gematria:40
Reversed Simple Gematria:95
Reversed English Gematria:570
Hebrew Gematria:0
Paleo Hebrew Gematria:0
Roman Numeral Gematria:21
Greek Isopsephy:0
Arabic Abjad:0
Satanic Gematria:401
Reverse Satanic:375
Primes Gematria:400
Reverse Primes:298
Trigonal Gematria:1160
Reverse Trigonal:796
Squares Gematria:2199
Reverse Squares:1497
Chaldean Numerology:36
Septenary Gematria:40
Single Reduction:49
Full Reduction KV:40
Single Reduction KV:49
Reverse Single Reduction:41
Reverse Full Reduction EP:59
Reverse Single Reduction EP:59
Reverse Extended:743
Jewish Reduction:42
Jewish Ordinal:114
ALW Kabbalah:127
KFW Kabbalah:159
LCH Kabbalah:105
Fibonacci Sequence:235
Keypad Gematria:49
Matching Word Cloud (Value: 298)
abbyafarafraanointarcturusaroundaspishauroraautotypeazoniumbabybalkbldgbummercalichancleddecldisunitydrivenectypeegaleightyfeffgaelgaleieeekaidkamalongermoonshotnobodyoffsetphilippiscesrocketschismshilohspherestackssynchrosthanksthe keytraitorstraumavikingwalletwheelswhiteoutzealous
View more matches for 298→"exiguous" stat:
Source: Word Database
Legal rate: 122
Rank:
