Gematria Calculation Result for intuition on Reverse Primes
The phrase "intuition" has a gematria value of 349 using the Reverse Primes system.
This is calculated by summing each letter's value: i(61) + n(41) + t(17) + u(13) + i(61) + t(17) + i(61) + o(37) + n(41).
intuition in other Gematria Types:
English Gematria:786
Simple Gematria:131
Jewish Gematria:557
Rabbis (Mispar Gadol):887
Reversed Reduced Gematria:58
Hebrew English Gematria:993
Reduced Gematria:50
Reversed Simple Gematria:112
Reversed English Gematria:672
Hebrew Gematria:0
Paleo Hebrew Gematria:0
Roman Numeral Gematria:8
Greek Isopsephy:0
Arabic Abjad:0
Satanic Gematria:446
Reverse Satanic:427
Primes Gematria:417
Reverse Primes:349
Trigonal Gematria:1116
Reverse Trigonal:850
Squares Gematria:2101
Reverse Squares:1588
Chaldean Numerology:34
Septenary Gematria:39
Single Reduction:50
Full Reduction KV:50
Single Reduction KV:50
Reverse Single Reduction:58
Reverse Full Reduction EP:58
Reverse Single Reduction EP:58
Reverse Extended:400
Jewish Reduction:44
Jewish Ordinal:125
ALW Kabbalah:169
KFW Kabbalah:169
LCH Kabbalah:101
Fibonacci Sequence:746
Keypad Gematria:54
Matching Word Cloud (Value: 349)
aciesadrowseailieairflowairlessaishaaleemaltezzaamusinganchovyashedautocuebeaksbeginbeingbelleborschtcameocavalcloyingcondomsconsolecrossletsdeadydimitriexorcistsfounderhadeshamsterharnessheadshillaryhotlinehypertelyidahointuitionnumericomahapreteritspseudonymrooseveltscreenssegmentshadetypicalunquicklyvampirevirginityyellingyeshuah
View more matches for 349→"intuition" stat:
Source: Word Database
Legal rate: 452
Rank: 2631
