Gematria Calculation Result for pointed on Reverse Primes
The phrase "pointed" has a gematria value of 349 using the Reverse Primes system.
This is calculated by summing each letter's value: p(31) + o(37) + i(61) + n(41) + t(17) + e(79) + d(83).
pointed in other Gematria Types:
English Gematria:498
Simple Gematria:83
Jewish Gematria:268
Rabbis (Mispar Gadol):398
Reversed Reduced Gematria:34
Hebrew English Gematria:598
Reduced Gematria:38
Reversed Simple Gematria:106
Reversed English Gematria:636
Hebrew Gematria:0
Paleo Hebrew Gematria:0
Roman Numeral Gematria:501
Greek Isopsephy:0
Arabic Abjad:0
Satanic Gematria:328
Reverse Satanic:351
Primes Gematria:255
Reverse Primes:349
Trigonal Gematria:641
Reverse Trigonal:963
Squares Gematria:1199
Reverse Squares:1820
Chaldean Numerology:34
Septenary Gematria:27
Single Reduction:38
Full Reduction KV:38
Single Reduction KV:38
Reverse Single Reduction:34
Reverse Full Reduction EP:61
Reverse Single Reduction EP:61
Reverse Extended:1087
Jewish Reduction:34
Jewish Ordinal:79
ALW Kabbalah:125
KFW Kabbalah:117
LCH Kabbalah:83
Fibonacci Sequence:521
Keypad Gematria:37
Matching Word Cloud (Value: 349)
adrowseailieairflowairlessaishaaleemaltezzaamusinganchovyanestrousantrovertapathusapoluneautocueauxofluorbeaksbeginbeingbellecameocavalcloyingconsoledammedimitridisrupterexorcistsfounderhadeshamsterharnesshillaryhypertelyidahoinheritintuitionnumericomahapreteritspseudonymrooseveltscreensshadeskeptictypicalunquicklyvampirevirginityyellingyeshuah
View more matches for 349→"pointed" stat:
Source: Word Database
Legal rate: 181
Rank: 534
