Gematria Calculation Result for preterits on Reverse Primes
The phrase "preterits" has a gematria value of 349 using the Reverse Primes system.
This is calculated by summing each letter's value: p(31) + r(23) + e(79) + t(17) + e(79) + r(23) + i(61) + t(17) + s(19).
preterits in other Gematria Types:
English Gematria:780
Simple Gematria:130
Jewish Gematria:529
Rabbis (Mispar Gadol):769
Reversed Reduced Gematria:59
Hebrew English Gematria:1589
Reduced Gematria:49
Reversed Simple Gematria:113
Reversed English Gematria:678
Hebrew Gematria:0
Paleo Hebrew Gematria:0
Roman Numeral Gematria:1
Greek Isopsephy:0
Arabic Abjad:0
Satanic Gematria:445
Reverse Satanic:428
Primes Gematria:429
Reverse Primes:349
Trigonal Gematria:1163
Reverse Trigonal:925
Squares Gematria:2196
Reverse Squares:1737
Chaldean Numerology:34
Septenary Gematria:48
Single Reduction:58
Full Reduction KV:49
Single Reduction KV:58
Reverse Single Reduction:59
Reverse Full Reduction EP:104
Reverse Single Reduction EP:104
Reverse Extended:950
Jewish Reduction:52
Jewish Ordinal:124
ALW Kabbalah:176
KFW Kabbalah:128
LCH Kabbalah:91
Fibonacci Sequence:248
Keypad Gematria:54
Matching Word Cloud (Value: 349)
aciesadrowseailieairflowairlessaishaaleemaltezzaamusinganchovyapathusashedautocuebeaksbeginbeingbelleborschtcameocavalcloyingcondomsconsoledammedeadydimitriexorcistsfounderhadeshamsterharnessheadshillaryhypertelyidahointuitionnumericomahapreteritspseudonymrooseveltscreenssegmentshadetypicalunquicklyvampirevirginityyellingyeshuah
View more matches for 349→"preterits" stat:
Source: Word Database
Legal rate: 258
Rank:
