Gematria Calculation Result for yarrow on Reverse Single Reduction
The phrase "yarrow" has a gematria value of 35 using the Reverse Single Reduction system.
This is calculated by summing each letter's value: y(2) + a(8) + r(9) + r(9) + o(3) + w(4).
yarrow in other Gematria Types:
English Gematria:600
Simple Gematria:100
Jewish Gematria:1511
Rabbis (Mispar Gadol):1441
Reversed Reduced Gematria:35
Hebrew English Gematria:477
Reduced Gematria:37
Reversed Simple Gematria:62
Reversed English Gematria:372
Hebrew Gematria:0
Paleo Hebrew Gematria:0
Roman Numeral Gematria:0
Greek Isopsephy:0
Arabic Abjad:0
Satanic Gematria:310
Reverse Satanic:272
Primes Gematria:351
Reverse Primes:194
Trigonal Gematria:1064
Reverse Trigonal:532
Squares Gematria:2028
Reverse Squares:1002
Chaldean Numerology:19
Septenary Gematria:19
Single Reduction:37
Full Reduction KV:37
Single Reduction KV:37
Reverse Single Reduction:35
Reverse Full Reduction EP:35
Reverse Single Reduction EP:35
Reverse Extended:854
Jewish Reduction:35
Jewish Ordinal:98
ALW Kabbalah:50
KFW Kabbalah:42
LCH Kabbalah:69
Fibonacci Sequence:217
Keypad Gematria:40
Matching Word Cloud (Value: 35)
aroundbreakcabalchaoschipschosenchuckdavisdecryptedwardeliasfailedfuturegatewayheavenirisjfk jrjfkjrjoannajosephjudaskingdomklausmacronmalikmonicanimrodnumberobjectoctopusperfectphoenixportalprisonralphreallyreviewrogersronaldsantasatansavageshinetakeofftattootaylortitanturkeyutopiawicked
View more matches for 35→"yarrow" stat:
Source: Word Database
Legal rate: 333
Rank: 864
