Gematria Calculation Result for abases on Reverse Trigonal
The phrase "abases" has a gematria value of 1352 using the Reverse Trigonal system.
This is calculated by summing each letter's value: a(351) + b(325) + a(351) + s(36) + e(253) + s(36).
abases in other Gematria Types:
English Gematria:282
Simple Gematria:47
Jewish Gematria:189
Rabbis (Mispar Gadol):209
Reversed Reduced Gematria:43
Hebrew English Gematria:609
Reduced Gematria:11
Reversed Simple Gematria:115
Reversed English Gematria:690
Hebrew Gematria:0
Paleo Hebrew Gematria:0
Roman Numeral Gematria:0
Greek Isopsephy:0
Arabic Abjad:0
Satanic Gematria:257
Reverse Satanic:325
Primes Gematria:152
Reverse Primes:416
Trigonal Gematria:400
Reverse Trigonal:1352
Squares Gematria:753
Reverse Squares:2589
Chaldean Numerology:15
Septenary Gematria:21
Single Reduction:29
Full Reduction KV:11
Single Reduction KV:29
Reverse Single Reduction:43
Reverse Full Reduction EP:61
Reverse Single Reduction EP:61
Reverse Extended:2716
Jewish Reduction:27
Jewish Ordinal:45
ALW Kabbalah:57
KFW Kabbalah:97
LCH Kabbalah:73
Fibonacci Sequence:50
Keypad Gematria:23
Matching Word Cloud (Value: 1352)
abasesabbaabsurderadulterouslyadverselyaeroductallegeralloiometryamerceramtracksaperitifsasphyxiedbababenefitbloodyingbutterflyerchampionchrismatoryconfusinglycotemporarycrystographcustodiandamneddemandeducatorelephantenteroplastyestaminetsexpertizedfellatioforethoughtgastrophilusgastroplastygermaniumhydrauluseshydroquinoneimagineinternalitymanfredmyelosyphilispelicanpolydispersitypsilocybepsychologistssiberiasimilitudestretchingsystemizationunforeseenungutturalness
View more matches for 1352→"abases" stat:
Source: Word Database
Legal rate: 214
Rank:
