Gematria Calculation Result for listlessness on Reverse Trigonal
The phrase "listlessness" has a gematria value of 1216 using the Reverse Trigonal system.
This is calculated by summing each letter's value: l(120) + i(171) + s(36) + t(28) + l(120) + e(253) + s(36) + s(36) + n(91) + e(253) + s(36) + s(36).
listlessness in other Gematria Types:
English Gematria:1032
Simple Gematria:172
Jewish Gematria:649
Rabbis (Mispar Gadol):829
Reversed Reduced Gematria:80
Hebrew English Gematria:2029
Reduced Gematria:37
Reversed Simple Gematria:152
Reversed English Gematria:912
Hebrew Gematria:0
Paleo Hebrew Gematria:0
Roman Numeral Gematria:101
Greek Isopsephy:0
Arabic Abjad:0
Satanic Gematria:592
Reverse Satanic:572
Primes Gematria:568
Reverse Primes:466
Trigonal Gematria:1496
Reverse Trigonal:1216
Squares Gematria:2820
Reverse Squares:2280
Chaldean Numerology:41
Septenary Gematria:57
Single Reduction:82
Full Reduction KV:37
Single Reduction KV:82
Reverse Single Reduction:80
Reverse Full Reduction EP:116
Reverse Single Reduction EP:116
Reverse Extended:1097
Jewish Reduction:73
Jewish Ordinal:163
ALW Kabbalah:140
KFW Kabbalah:228
LCH Kabbalah:136
Fibonacci Sequence:683
Keypad Gematria:69
Matching Word Cloud (Value: 1216)
aculeiagavesamicesariledarmigersarmipotentasemicatavicbhowanibulliformbutylationbyepathcaronachronometrycounterswaycourgettediluviandiscussiondisordersdyslexiaectozoansexospheresfevertwigflywheelsforthrightharvesterhepatostomyindoxyliciterationluminarismmethanolminutemannonassisterokeydokeypseudaxisputtyheadregardsreweavessamaelsavagesimpsons theorysouth koreatelevisiontesseratomythe unseenthresholdtraitorwiseventilatorsvolunteerismwaterworld
View more matches for 1216→"listlessness" stat:
Source: Word Database
Legal rate: 54
Rank: