Gematria Calculation Result for ciseaux on Reversed Simple Gematria
The phrase "ciseaux" has a gematria value of 107 using the Reversed Simple Gematria system.
This is calculated by summing each letter's value: c(24) + i(18) + s(8) + e(22) + a(26) + u(6) + x(3).
ciseaux in other Gematria Types:
English Gematria:492
Simple Gematria:82
Jewish Gematria:608
Rabbis (Mispar Gadol):1018
Reversed Reduced Gematria:44
Hebrew English Gematria:414
Reduced Gematria:28
Reversed Simple Gematria:107
Reversed English Gematria:642
Hebrew Gematria:0
Paleo Hebrew Gematria:0
Roman Numeral Gematria:116
Greek Isopsephy:0
Arabic Abjad:0
Satanic Gematria:327
Reverse Satanic:352
Primes Gematria:270
Reverse Primes:367
Trigonal Gematria:788
Reverse Trigonal:1138
Squares Gematria:1494
Reverse Squares:2169
Chaldean Numerology:24
Septenary Gematria:29
Single Reduction:37
Full Reduction KV:28
Single Reduction KV:37
Reverse Single Reduction:44
Reverse Full Reduction EP:62
Reverse Single Reduction EP:62
Reverse Extended:1907
Jewish Reduction:32
Jewish Ordinal:77
ALW Kabbalah:106
KFW Kabbalah:122
LCH Kabbalah:66
Fibonacci Sequence:73
Keypad Gematria:35
Matching Word Cloud (Value: 107)
abaseactivityalmucealpheusbergerbowlingbubbacorrectedwardespanoleveryoneexecutoryfieldsflippergatewayglassesharariheavenhigherjoannalargestlinkedmakingmariammenstruumsminervamonicaobjectphillippositionsrainbowrecordsregularremovedsavagescorpionseattlesharedsimplifyspawnedsuccubussunshinethunderstrillionuncensorvitruvianvolcanowaterloowickedwormhole
View more matches for 107→"ciseaux" stat:
Source: Word Database
Legal rate: 332
Rank:
