Gematria Calculation Result for refusal on Reversed Simple Gematria
The phrase "refusal" has a gematria value of 107 using the Reversed Simple Gematria system.
This is calculated by summing each letter's value: r(9) + e(22) + f(21) + u(6) + s(8) + a(26) + l(15).
refusal in other Gematria Types:
English Gematria:492
Simple Gematria:82
Jewish Gematria:402
Rabbis (Mispar Gadol):532
Reversed Reduced Gematria:44
Hebrew English Gematria:548
Reduced Gematria:28
Reversed Simple Gematria:107
Reversed English Gematria:642
Hebrew Gematria:0
Paleo Hebrew Gematria:0
Roman Numeral Gematria:55
Greek Isopsephy:0
Arabic Abjad:0
Satanic Gematria:327
Reverse Satanic:352
Primes Gematria:264
Reverse Primes:355
Trigonal Gematria:707
Reverse Trigonal:1057
Squares Gematria:1332
Reverse Squares:2007
Chaldean Numerology:28
Septenary Gematria:31
Single Reduction:37
Full Reduction KV:28
Single Reduction KV:37
Reverse Single Reduction:44
Reverse Full Reduction EP:62
Reverse Single Reduction EP:62
Reverse Extended:1583
Jewish Reduction:33
Jewish Ordinal:78
ALW Kabbalah:80
KFW Kabbalah:96
LCH Kabbalah:85
Fibonacci Sequence:221
Keypad Gematria:35
Matching Word Cloud (Value: 107)
abaseactivityalmucealpheusbergerbowlingbubbacorrectedwardespanoleveryoneexecutoryfieldsflippergatewayglassesharariheavenhigherjoannalargestlinkedmakingmariammenstruumsminervamonicamoroccoobjectphillippositionsrainbowrecordsregularremovedsavagescorpionseattlesharedsimplifyspawnedsuccubussunshinethunderstrillionvitruvianvolcanowaterloowickedwormhole
View more matches for 107→"refusal" stat:
Source: Word Database
Legal rate: 265
Rank: 529
