Gematria Calculation Result for revised on Reversed Simple Gematria
The phrase "revised" has a gematria value of 107 using the Reversed Simple Gematria system.
This is calculated by summing each letter's value: r(9) + e(22) + v(5) + i(18) + s(8) + e(22) + d(23).
revised in other Gematria Types:
English Gematria:492
Simple Gematria:82
Jewish Gematria:893
Rabbis (Mispar Gadol):613
Reversed Reduced Gematria:44
Hebrew English Gematria:529
Reduced Gematria:37
Reversed Simple Gematria:107
Reversed English Gematria:642
Hebrew Gematria:0
Paleo Hebrew Gematria:0
Roman Numeral Gematria:506
Greek Isopsephy:0
Arabic Abjad:0
Satanic Gematria:327
Reverse Satanic:352
Primes Gematria:259
Reverse Primes:355
Trigonal Gematria:699
Reverse Trigonal:1049
Squares Gematria:1316
Reverse Squares:1991
Chaldean Numerology:26
Septenary Gematria:35
Single Reduction:46
Full Reduction KV:55
Single Reduction KV:64
Reverse Single Reduction:44
Reverse Full Reduction EP:80
Reverse Single Reduction EP:80
Reverse Extended:1412
Jewish Reduction:47
Jewish Ordinal:83
ALW Kabbalah:106
KFW Kabbalah:98
LCH Kabbalah:100
Fibonacci Sequence:107
Keypad Gematria:35
Matching Word Cloud (Value: 107)
abaseactivityalmucealpheusbergerbowlingbubbacorrectedwardespanoleveryoneexecutoryfieldsflippergatewayglassesharariheavenhigherjoannalargestlinkedmakingmariammenstruumsminervamonicaobjectphillippositionsrainbowrecordsregularremovedsavagescorpionseattlesharedsimplifysolacespawnedsuccubussunshinethunderstrillionvitruvianvolcanowaterloowickedwormhole
View more matches for 107→"revised" stat:
Source: Word Database
Legal rate: 250
Rank: 403
