Gematria Calculation Result for checkmate on Simple Gematria
The phrase "checkmate" has a gematria value of 69 using the Simple Gematria system.
This is calculated by summing each letter's value: c(3) + h(8) + e(5) + c(3) + k(11) + m(13) + a(1) + t(20) + e(5).
checkmate in other Gematria Types:
English Gematria:414
Simple Gematria:69
Jewish Gematria:165
Rabbis (Mispar Gadol):285
Reversed Reduced Gematria:48
Hebrew English Gematria:485
Reduced Gematria:33
Reversed Simple Gematria:174
Reversed English Gematria:1044
Hebrew Gematria:0
Paleo Hebrew Gematria:0
Roman Numeral Gematria:1200
Greek Isopsephy:0
Arabic Abjad:0
Satanic Gematria:384
Reverse Satanic:489
Primes Gematria:196
Reverse Primes:617
Trigonal Gematria:446
Reverse Trigonal:1916
Squares Gematria:823
Reverse Squares:3658
Chaldean Numerology:32
Septenary Gematria:34
Single Reduction:33
Full Reduction KV:42
Single Reduction KV:42
Reverse Single Reduction:57
Reverse Full Reduction EP:84
Reverse Single Reduction EP:93
Reverse Extended:3027
Jewish Reduction:30
Jewish Ordinal:66
ALW Kabbalah:135
KFW Kabbalah:95
LCH Kabbalah:85
Fibonacci Sequence:371
Keypad Gematria:35
Matching Word Cloud (Value: 69)
andvarianimalsarchangelatlantabarracudabeyoncebinaryblackboardchartscheckmatecurvedebuggerdrugseclipseghosthappenedhusbandindicatedjehovahjeremiahkennyknightlemonademalcolmmammonmessagemexicomillermithranovempandorapeopleportqueuereflectreleasedrileyservesmithspitetauritexastextvalhallavenomvivekvoltwealthwormzoom
View more matches for 69→"checkmate" stat:
Source: Word Database
Legal rate: 554
Rank: 9083
