Gematria Calculation Result for listed on Simple Gematria
The phrase "listed" has a gematria value of 69 using the Simple Gematria system.
This is calculated by summing each letter's value: l(12) + i(9) + s(19) + t(20) + e(5) + d(4).
listed in other Gematria Types:
English Gematria:414
Simple Gematria:69
Jewish Gematria:228
Rabbis (Mispar Gadol):348
Reversed Reduced Gematria:39
Hebrew English Gematria:748
Reduced Gematria:24
Reversed Simple Gematria:93
Reversed English Gematria:558
Hebrew Gematria:0
Paleo Hebrew Gematria:0
Roman Numeral Gematria:551
Greek Isopsephy:0
Arabic Abjad:0
Satanic Gematria:279
Reverse Satanic:303
Primes Gematria:216
Reverse Primes:306
Trigonal Gematria:548
Reverse Trigonal:884
Squares Gematria:1027
Reverse Squares:1675
Chaldean Numerology:20
Septenary Gematria:29
Single Reduction:33
Full Reduction KV:24
Single Reduction KV:33
Reverse Single Reduction:39
Reverse Full Reduction EP:57
Reverse Single Reduction EP:57
Reverse Extended:1065
Jewish Reduction:30
Jewish Ordinal:66
ALW Kabbalah:85
KFW Kabbalah:93
LCH Kabbalah:61
Fibonacci Sequence:220
Keypad Gematria:30
Matching Word Cloud (Value: 69)
andvarianimalsarchangelatlantabarracudabeyoncebinaryblackboardchartscheckmatecurvedebuggerdrugseclipseghosthappenedhusbandindicatedjehovahjeremiahkennyknightlemonademalcolmmammonmessagemexicomillermithranovempandorapeopleportqueuereflectreleasedrileyservesmithspitetauritexastextvalhallavenomvivekvoltwealthwormzoom
View more matches for 69→"listed" stat:
Source: Word Database
Legal rate: 198
Rank: 503
