Gematria Calculation Result for abraxas on Simple Gematria
The phrase "abraxas" has a gematria value of 66 using the Simple Gematria system.
This is calculated by summing each letter's value: a(1) + b(2) + r(18) + a(1) + x(24) + a(1) + s(19).
abraxas in other Gematria Types:
English Gematria:396
Simple Gematria:66
Jewish Gematria:475
Rabbis (Mispar Gadol):795
Reversed Reduced Gematria:51
Hebrew English Gematria:595
Reduced Gematria:21
Reversed Simple Gematria:123
Reversed English Gematria:738
Hebrew Gematria:0
Paleo Hebrew Gematria:0
Roman Numeral Gematria:10
Greek Isopsephy:0
Arabic Abjad:0
Satanic Gematria:311
Reverse Satanic:368
Primes Gematria:226
Reverse Primes:447
Trigonal Gematria:667
Reverse Trigonal:1465
Squares Gematria:1268
Reverse Squares:2807
Chaldean Numerology:15
Septenary Gematria:19
Single Reduction:30
Full Reduction KV:21
Single Reduction KV:30
Reverse Single Reduction:51
Reverse Full Reduction EP:51
Reverse Single Reduction EP:51
Reverse Extended:3120
Jewish Reduction:25
Jewish Ordinal:61
ALW Kabbalah:62
KFW Kabbalah:86
LCH Kabbalah:70
Fibonacci Sequence:61
Keypad Gematria:31
Matching Word Cloud (Value: 66)
abraxasabyssaddendumancientanubisbackdatesblessedbundycardboardcatfishcharlesclassiccoreycoronacursedenmarkdialecticenvyeventfamilyfiftyfreedomgrapeshappyjessicalostlululyonmanuelmolochmortmythonlypixelplannedpopspumpqueerrubyrushseerssinglesnuffsugarthuletimestwinuponweddingwoman
View more matches for 66→"abraxas" stat:
Source: Word Database
Legal rate: 513
Rank: 4360