Gematria Calculation Result for abyss on Simple Gematria
The phrase "abyss" has a gematria value of 66 using the Simple Gematria system.
This is calculated by summing each letter's value: a(1) + b(2) + y(25) + s(19) + s(19).
abyss in other Gematria Types:
English Gematria:396
Simple Gematria:66
Jewish Gematria:583
Rabbis (Mispar Gadol):903
Reversed Reduced Gematria:33
Hebrew English Gematria:613
Reduced Gematria:12
Reversed Simple Gematria:69
Reversed English Gematria:414
Hebrew Gematria:0
Paleo Hebrew Gematria:0
Roman Numeral Gematria:0
Greek Isopsephy:0
Arabic Abjad:0
Satanic Gematria:241
Reverse Satanic:244
Primes Gematria:236
Reverse Primes:239
Trigonal Gematria:709
Reverse Trigonal:751
Squares Gematria:1352
Reverse Squares:1433
Chaldean Numerology:10
Septenary Gematria:17
Single Reduction:30
Full Reduction KV:12
Single Reduction KV:30
Reverse Single Reduction:33
Reverse Full Reduction EP:33
Reverse Single Reduction EP:33
Reverse Extended:1518
Jewish Reduction:25
Jewish Ordinal:61
ALW Kabbalah:46
KFW Kabbalah:78
LCH Kabbalah:73
Fibonacci Sequence:45
Keypad Gematria:27
Matching Word Cloud (Value: 66)
abraxasabyssaddendumancientanubisbackdatesblessedbundycatfishcharlesclassiccoreycoronacursedenmarkdialecticenvyeventfamilyfiftyfreedomgrapeshappyjessicalinkablelostlululyonmanuelmolochmortmythonlypixelplannedpopspumpqueerrubyrushseerssinglesnuffsugarthuletimestwinuponweddingwoman
View more matches for 66→"abyss" stat:
Source: Word Database
Legal rate: 467
Rank: 3696
