Gematria Calculation Result for anubis on Simple Gematria
The phrase "anubis" has a gematria value of 66 using the Simple Gematria system.
This is calculated by summing each letter's value: a(1) + n(14) + u(21) + b(2) + i(9) + s(19).
anubis in other Gematria Types:
English Gematria:396
Simple Gematria:66
Jewish Gematria:342
Rabbis (Mispar Gadol):462
Reversed Reduced Gematria:42
Hebrew English Gematria:368
Reduced Gematria:21
Reversed Simple Gematria:96
Reversed English Gematria:576
Hebrew Gematria:0
Paleo Hebrew Gematria:0
Roman Numeral Gematria:6
Greek Isopsephy:0
Arabic Abjad:0
Satanic Gematria:276
Reverse Satanic:306
Primes Gematria:211
Reverse Primes:332
Trigonal Gematria:575
Reverse Trigonal:995
Squares Gematria:1084
Reverse Squares:1894
Chaldean Numerology:18
Septenary Gematria:21
Single Reduction:30
Full Reduction KV:21
Single Reduction KV:30
Reverse Single Reduction:42
Reverse Full Reduction EP:42
Reverse Single Reduction EP:42
Reverse Extended:1644
Jewish Reduction:27
Jewish Ordinal:63
ALW Kabbalah:80
KFW Kabbalah:120
LCH Kabbalah:89
Fibonacci Sequence:298
Keypad Gematria:29
Matching Word Cloud (Value: 66)
abraxasabyssaddendumancientanubisbackdatesblessedbundycatfishcharlesclassiccoreycoronacursedenmarkdialecticenvyeventfamilyfiftyfreedomgrapeshappyjessicalinkablelostlululyonmanuelmolochmythonlypixelplannedpopspumpqueerrubyrushsampleseerssinglesnuffsugarthuletimestwinuponweddingwoman
View more matches for 66→"anubis" stat:
Source: Word Database
Legal rate: 639
Rank: 4454
