Gematria Calculation Result for pump on Simple Gematria
The phrase "pump" has a gematria value of 66 using the Simple Gematria system.
This is calculated by summing each letter's value: p(16) + u(21) + m(13) + p(16).
pump in other Gematria Types:
English Gematria:396
Simple Gematria:66
Jewish Gematria:350
Rabbis (Mispar Gadol):480
Reversed Reduced Gematria:15
Hebrew English Gematria:186
Reduced Gematria:21
Reversed Simple Gematria:42
Reversed English Gematria:252
Hebrew Gematria:0
Paleo Hebrew Gematria:0
Roman Numeral Gematria:1005
Greek Isopsephy:0
Arabic Abjad:0
Satanic Gematria:206
Reverse Satanic:182
Primes Gematria:220
Reverse Primes:118
Trigonal Gematria:594
Reverse Trigonal:258
Squares Gematria:1122
Reverse Squares:474
Chaldean Numerology:26
Septenary Gematria:13
Single Reduction:21
Full Reduction KV:21
Single Reduction KV:21
Reverse Single Reduction:15
Reverse Full Reduction EP:33
Reverse Single Reduction EP:33
Reverse Extended:96
Jewish Reduction:17
Jewish Ordinal:62
ALW Kabbalah:90
KFW Kabbalah:82
LCH Kabbalah:54
Fibonacci Sequence:419
Keypad Gematria:28
Matching Word Cloud (Value: 66)
abraxasabyssaddendumancientanubisbackdatesblessedbundycatfishcharlesclassiccoreycoronacursedenmarkdialecticenvyeventfamilyfiftyfreedomgrapeshappyjessicalinkablelostlululyonmanuelmolochmortmythonlypixelplannedpopspumpqueerrubyrushseerssinglesnuffsugarthuletimestwinuponweddingwoman
View more matches for 66→"pump" stat:
Source: Word Database
Legal rate: 514
Rank: 1523
