Gematria Calculation Result for addendum on Simple Gematria
The phrase "addendum" has a gematria value of 66 using the Simple Gematria system.
This is calculated by summing each letter's value: a(1) + d(4) + d(4) + e(5) + n(14) + d(4) + u(21) + m(13).
addendum in other Gematria Types:
English Gematria:396
Simple Gematria:66
Jewish Gematria:288
Rabbis (Mispar Gadol):408
Reversed Reduced Gematria:42
Hebrew English Gematria:114
Reduced Gematria:30
Reversed Simple Gematria:150
Reversed English Gematria:900
Hebrew Gematria:0
Paleo Hebrew Gematria:0
Roman Numeral Gematria:2505
Greek Isopsephy:0
Arabic Abjad:0
Satanic Gematria:346
Reverse Satanic:430
Primes Gematria:191
Reverse Primes:526
Trigonal Gematria:473
Reverse Trigonal:1649
Squares Gematria:880
Reverse Squares:3148
Chaldean Numerology:33
Septenary Gematria:26
Single Reduction:30
Full Reduction KV:30
Single Reduction KV:30
Reverse Single Reduction:42
Reverse Full Reduction EP:60
Reverse Single Reduction EP:60
Reverse Extended:2796
Jewish Reduction:27
Jewish Ordinal:63
ALW Kabbalah:96
KFW Kabbalah:96
LCH Kabbalah:157
Fibonacci Sequence:489
Keypad Gematria:34
Matching Word Cloud (Value: 66)
abraxasabyssaddendumancientanubisbackdatesblessedbundycatfishcharlesclassiccoreycoronacursedenmarkdialecticenvyeventfamilyfiftyfreedomgrapeshappyjessicalinkablelostlululyonmanuelmolochmythonlypixelplannedpopspumpqueerrubyrushsampleseerssinglesnuffsugarthuletimestwinuponweddingwoman
View more matches for 66→"addendum" stat:
Source: Word Database
Legal rate: 485
Rank: 779
