Gematria Calculation Result for admits on Simple Gematria
The phrase "admits" has a gematria value of 66 using the Simple Gematria system.
This is calculated by summing each letter's value: a(1) + d(4) + m(13) + i(9) + t(20) + s(19).
admits in other Gematria Types:
English Gematria:396
Simple Gematria:66
Jewish Gematria:234
Rabbis (Mispar Gadol):354
Reversed Reduced Gematria:42
Hebrew English Gematria:754
Reduced Gematria:21
Reversed Simple Gematria:96
Reversed English Gematria:576
Hebrew Gematria:0
Paleo Hebrew Gematria:0
Roman Numeral Gematria:1501
Greek Isopsephy:0
Arabic Abjad:0
Satanic Gematria:276
Reverse Satanic:306
Primes Gematria:211
Reverse Primes:324
Trigonal Gematria:547
Reverse Trigonal:967
Squares Gematria:1028
Reverse Squares:1838
Chaldean Numerology:17
Septenary Gematria:24
Single Reduction:30
Full Reduction KV:21
Single Reduction KV:30
Reverse Single Reduction:42
Reverse Full Reduction EP:42
Reverse Single Reduction EP:42
Reverse Extended:1455
Jewish Reduction:27
Jewish Ordinal:63
ALW Kabbalah:80
KFW Kabbalah:72
LCH Kabbalah:73
Fibonacci Sequence:305
Keypad Gematria:30
Matching Word Cloud (Value: 66)
abraxasabyssaddendumancientanubisbackdatesblessedbundycatfishcharlesclassiccoreycoronacursedenmarkdialecticenvyeventfamilyfiftyfreedomgrapeshappyjessicalinkablelostlululyonmanuelmolochmortmythonlypixelplannedpopspumpqueerrubyrushseerssinglesnuffsugarthuletimestwinuponweddingwoman
View more matches for 66→"admits" stat:
Source: Word Database
Legal rate: 191
Rank:
