Gematria Calculation Result for incus on Simple Gematria
The phrase "incus" has a gematria value of 66 using the Simple Gematria system.
This is calculated by summing each letter's value: i(9) + n(14) + c(3) + u(21) + s(19).
incus in other Gematria Types:
English Gematria:396
Simple Gematria:66
Jewish Gematria:342
Rabbis (Mispar Gadol):462
Reversed Reduced Gematria:33
Hebrew English Gematria:368
Reduced Gematria:21
Reversed Simple Gematria:69
Reversed English Gematria:414
Hebrew Gematria:0
Paleo Hebrew Gematria:0
Roman Numeral Gematria:106
Greek Isopsephy:0
Arabic Abjad:0
Satanic Gematria:241
Reverse Satanic:244
Primes Gematria:211
Reverse Primes:223
Trigonal Gematria:577
Reverse Trigonal:619
Squares Gematria:1088
Reverse Squares:1169
Chaldean Numerology:18
Septenary Gematria:21
Single Reduction:30
Full Reduction KV:21
Single Reduction KV:30
Reverse Single Reduction:33
Reverse Full Reduction EP:33
Reverse Single Reduction EP:33
Reverse Extended:744
Jewish Reduction:27
Jewish Ordinal:63
ALW Kabbalah:72
KFW Kabbalah:104
LCH Kabbalah:66
Fibonacci Sequence:298
Keypad Gematria:27
Matching Word Cloud (Value: 66)
abraxasabyssaddendumancientanubisbackdatesblessedbundycardboardcatfishcharlesclassiccoreycoronacursedenmarkdialecticenvyeventfamilyfiftyfreedomgrapeshappyjessicalostlululyonmanuelmolochmortmythonlypixelplannedpopspumpqueerrubyrushseerssinglesnuffsugarthuletimestwinuponweddingwoman
View more matches for 66→"incus" stat:
Source: Word Database
Legal rate: 16
Rank:
