Gematria Calculation Result for minoan on Simple Gematria
The phrase "minoan" has a gematria value of 66 using the Simple Gematria system.
This is calculated by summing each letter's value: m(13) + i(9) + n(14) + o(15) + a(1) + n(14).
minoan in other Gematria Types:
English Gematria:396
Simple Gematria:66
Jewish Gematria:170
Rabbis (Mispar Gadol):210
Reversed Reduced Gematria:33
Hebrew English Gematria:210
Reduced Gematria:30
Reversed Simple Gematria:96
Reversed English Gematria:576
Hebrew Gematria:0
Paleo Hebrew Gematria:0
Roman Numeral Gematria:1001
Greek Isopsephy:0
Arabic Abjad:0
Satanic Gematria:276
Reverse Satanic:306
Primes Gematria:199
Reverse Primes:324
Trigonal Gematria:467
Reverse Trigonal:887
Squares Gematria:868
Reverse Squares:1678
Chaldean Numerology:23
Septenary Gematria:11
Single Reduction:30
Full Reduction KV:30
Single Reduction KV:30
Reverse Single Reduction:33
Reverse Full Reduction EP:33
Reverse Single Reduction EP:33
Reverse Extended:1050
Jewish Reduction:26
Jewish Ordinal:62
ALW Kabbalah:80
KFW Kabbalah:96
LCH Kabbalah:84
Fibonacci Sequence:878
Keypad Gematria:30
Matching Word Cloud (Value: 66)
ablatingabraxasabyssaddendumancientanubisbackdatesblessedbundycatfishcharlesclassiccoreycoronacursedenmarkdialecticeventfamilyfiftyfreedomgrapeshappyjessicalinkablelostlululyonmanuelmolochmythonlypixelplannedpopspumpqueerrubyrushsampleseerssinglesnuffsugarthuletimestwinuponweddingwoman
View more matches for 66→"minoan" stat:
Source: Word Database
Legal rate: 244
Rank: 491