Gematria Calculation Result for retard on Simple Gematria
The phrase "retard" has a gematria value of 66 using the Simple Gematria system.
This is calculated by summing each letter's value: r(18) + e(5) + t(20) + a(1) + r(18) + d(4).
retard in other Gematria Types:
English Gematria:396
Simple Gematria:66
Jewish Gematria:270
Rabbis (Mispar Gadol):390
Reversed Reduced Gematria:42
Hebrew English Gematria:810
Reduced Gematria:30
Reversed Simple Gematria:96
Reversed English Gematria:576
Hebrew Gematria:0
Paleo Hebrew Gematria:0
Roman Numeral Gematria:500
Greek Isopsephy:0
Arabic Abjad:0
Satanic Gematria:276
Reverse Satanic:306
Primes Gematria:213
Reverse Primes:326
Trigonal Gematria:578
Reverse Trigonal:998
Squares Gematria:1090
Reverse Squares:1900
Chaldean Numerology:18
Septenary Gematria:27
Single Reduction:30
Full Reduction KV:30
Single Reduction KV:30
Reverse Single Reduction:42
Reverse Full Reduction EP:60
Reverse Single Reduction EP:60
Reverse Extended:1725
Jewish Reduction:27
Jewish Ordinal:63
ALW Kabbalah:80
KFW Kabbalah:48
LCH Kabbalah:78
Fibonacci Sequence:90
Keypad Gematria:30
Matching Word Cloud (Value: 66)
abraxasabyssaddendumancientanubisbackdatesblessedbundycardboardcatfishcharlesclassiccoreycoronacursedenmarkdialecticenvyeventfamilyfiftyfreedomgrapeshappyjessicalostlululyonmanuelmolochmortmythonlypixelplannedpopspumpqueerrubyrushseerssinglesnuffsugarthuletimestwinuponweddingwoman
View more matches for 66→"retard" stat:
Source: Word Database
Legal rate: 265
Rank: 1430
